PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G41500.1
Common NameLOC102722659
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 240aa    MW: 26874.3 Da    PI: 6.5223
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G41500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.95.5e-281059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  rienk+ rqvtf+kRrng+lKKA+ELS+LCdaeva+++fs+ g+ly +ss
  OB03G41500.1 10 RIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALVLFSHAGRLYQFSS 59
                  9***********************************************96 PP

2K-box94.71.6e-31781744100
         K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                   ++ ++ ++ ++++ +qe+ +Lk+++e Lq++qR+llGedL +L+  eL qLe q+ + lk+iRs+K+++l++++ +l++ke++lq++n  L++kl+e
  OB03G41500.1  78 QDASAPASDEMQNNYQEYVNLKAQVEVLQHSQRNLLGEDLAPLNTDELDQLEGQVVRTLKQIRSRKTQVLVDELCDLKRKEQMLQDANSVLKRKLDE 174
                   4455578889************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.02161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-36160IPR002100Transcription factor, MADS-box
CDDcd002652.23E-41279No hitNo description
SuperFamilySSF554558.89E-31282IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-293859IPR002100Transcription factor, MADS-box
PfamPF014867.1E-2885172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.75788178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRGKVVLQR IENKISRQVT FAKRRNGLLK KAYELSILCD AEVALVLFSH AGRLYQFSSS  60
SNMLKTLERY QRYIYASQDA SAPASDEMQN NYQEYVNLKA QVEVLQHSQR NLLGEDLAPL  120
NTDELDQLEG QVVRTLKQIR SRKTQVLVDE LCDLKRKEQM LQDANSVLKR KLDEIDVETP  180
SPQPTWNGNC TGNSGGGGGG VFSSEPPQPE HFFQALGFHA VDVNQPPAPP PGGYPPEWMA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D4e-209317222101Developmental protein SEPALLATA 3
4ox0_C4e-209317222101Developmental protein SEPALLATA 3
4ox0_B4e-209317222101Developmental protein SEPALLATA 3
4ox0_A4e-209317222101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033240.0AB003324.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E31254.
GenBankAY5519170.0AY551917.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS212 mRNA, complete cds.
GenBankAY5519220.0AY551922.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS217 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006650603.11e-180PREDICTED: MADS-box transcription factor 34
RefseqXP_015690740.11e-180PREDICTED: MADS-box transcription factor 34
SwissprotQ6Q9H61e-142MAD34_ORYSJ; MADS-box transcription factor 34
TrEMBLJ3LSX41e-180J3LSX4_ORYBR; Uncharacterized protein
STRINGOB03G41500.11e-180(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136182630
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.11e-74MIKC_MADS family protein